PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G050400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 146aa    MW: 15989 Da    PI: 10.2721
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G050400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.81.3e-142685463
                        XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                         ++ +r+ +NRe+ArrsR+RK++++eeL  +v+ L+aeN + + ++ +   e +k++ e+
  Sevir.3G050400.1.p 26 ERKRKRMLSNRESARRSRARKQQRLEELVAEVARLQAENAQVQTRIATFDRELSKVDGEN 85
                        46789999************************************9999999988887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.9E-192387IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.1742588IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-122581No hitNo description
PfamPF001705.9E-112781IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.25E-112779No hitNo description
PROSITE patternPS0003603045IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MSSRRSPSPD SNTDSGSAGG GFAADERKRK RMLSNRESAR RSRARKQQRL EELVAEVARL  60
QAENAQVQTR IATFDRELSK VDGENAVLRA RHGELAGRLE SLGGVLEVLQ MAGAPVDIPE  120
IPDPLLRPWQ PPFPMQPIAA DAFQF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13946RRSRARKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9766712e-85EU976671.1 Zea mays clone 986724 ocs element-binding factor 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960384.11e-100PREDICTED: bZIP transcription factor 53-like
TrEMBLK3ZAJ11e-100K3ZAJ1_SETIT; Uncharacterized protein
STRINGSi023562m1e-100(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188635100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.11e-27basic region/leucine zipper motif 53